SCOPe 2.08: Domain d1a8vb2: 1a8v B:48-118

Lineage for d1a8vb2 (1a8v B:48-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
   Uniprot P03002

8. Domain d1a8vb2: 1a8v B:48-118 [64715]
   Other proteins in same PDB: d1a8va1, d1a8vb1
   complexed with cu

Details for d1a8vb2

PDB Entry: 1a8v, 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator

PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d1a8vb2:

Sequence, based on SEQRES records:

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

Sequence, based on observed residues (ATOM records):

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadagpddiyvspsqirrfnlrtgdtisgkirppkegeryf
allkvne

Timeline for d1a8vb2:

• d1a8vb2 first appeared in SCOP 1.59
  
• d1a8vb2 appears in SCOPe 2.07