![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
![]() | Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) ![]() |
![]() | Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) automatically mapped to Pfam PF07498 |
![]() | Protein Rho termination factor, N-terminal domain [68914] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) Uniprot P03002 |
![]() | Domain d1a8va1: 1a8v A:-1-47 [64712] Other proteins in same PDB: d1a8va2, d1a8vb2 complexed with cu |
PDB Entry: 1a8v (more details), 2 Å
SCOPe Domain Sequences for d1a8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8va1 a.140.3.1 (A:-1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1a8va1: