SCOPe 2.08: Domain d1i0ua1: 1i0u A:1-41

Lineage for d1i0ua1 (1i0u A:1-41)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
   Uniprot P01130 272-353

8. Domain d1i0ua1: 1i0u A:1-41 [61493]
   complexed with ca

Details for d1i0ua1

PDB Entry: 1i0u

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor

PDB Compounds: (A:) low density lipoprotein receptor

SCOPe Domain Sequences for d1i0ua1:

Sequence; same for both SEQRES and ATOM records:

>d1i0ua1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

Timeline for d1i0ua1:

• d1i0ua1 first appeared in SCOP 1.57
  
• d1i0ua1 appears in SCOPe 2.07