SCOP 1.57: Domain d1i0ua1: 1i0u A:1-41

Lineage for d1i0ua1 (1i0u A:1-41)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (5 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (4 PDB entries)

8. Domain d1i0ua1: 1i0u A:1-41 [61493]

Details for d1i0ua1

PDB Entry: 1i0u

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor

SCOP Domain Sequences for d1i0ua1:

Sequence; same for both SEQRES and ATOM records:

>d1i0ua1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

Timeline for d1i0ua1:

• d1i0ua1 is new in SCOP 1.57
  
• d1i0ua1 appears in SCOP 1.59
  
• d1i0ua1 appears in the current release, SCOPe 2.08