Lineage for d1i0ua1 (1i0u A:1-41)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636253Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 2636254Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 2636258Domain d1i0ua1: 1i0u A:1-41 [61493]
    complexed with ca

Details for d1i0ua1

PDB Entry: 1i0u (more details)

PDB Description: solution structure and backbone dynamics of a concatemer of egf- homology modules of the human low density lipoprotein receptor
PDB Compounds: (A:) low density lipoprotein receptor

SCOPe Domain Sequences for d1i0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ua1 g.3.11.1 (A:1-41) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

SCOPe Domain Coordinates for d1i0ua1:

Click to download the PDB-style file with coordinates for d1i0ua1.
(The format of our PDB-style files is described here.)

Timeline for d1i0ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0ua2