Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1fneb1: 1fne B:93-188 [59898] Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb2, d1fnec1, d1fnec2, d1fned2 contains covalently bound peptides at the N-termini of chains B and D complexed with nag |
PDB Entry: 1fne (more details), 1.9 Å
SCOPe Domain Sequences for d1fneb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fneb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd wtfqtlvmletvpqsgevytcqvehpsltdpvtvew
Timeline for d1fneb1: