| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries) |
| Domain d1fnea2: 1fne A:1-81 [59897] Other proteins in same PDB: d1fnea1, d1fneb1, d1fneb2, d1fnec1, d1fned1, d1fned2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1fne (more details), 1.9 Å
SCOPe Domain Sequences for d1fnea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnea2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp
Timeline for d1fnea2: