PDB entry 1fne

View 1fne on RCSB PDB site
Description: histocompatibility antigen
Class: immune system
Keywords: histocompatibility antigen, MHC, immune system
Deposited on 2000-08-21, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (MHC class II I-ek, alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fnea1, d1fnea2
  • Chain 'B':
    Compound: protein (MHC class II I-ek, beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (30-34)
      • mutation (31)
    • GB 199398 (29-End)
    Domains in SCOPe 2.07: d1fneb1, d1fneb2
  • Chain 'C':
    Compound: protein (MHC class II I-ek, alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fnec1, d1fnec2
  • Chain 'D':
    Compound: protein (MHC class II I-ek, beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02089 (30-34)
      • mutation (31)
    • GB 199398 (29-End)
    Domains in SCOPe 2.07: d1fned1, d1fned2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fneA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fneA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fneB (B:)
    gkkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fneB (B:)
    kkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fneC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fneC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fneD (D:)
    gkkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fneD (D:)
    kkvitafndglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynle
    enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprrv
    eptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwtf
    qtlvmletvpqsgevytcqvehpsltdpvtvew