Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries) |
Domain d1fned2: 1fne D:4-92 [59903] Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb1, d1fnec1, d1fnec2, d1fned1 contains covalently bound peptides at the N-termini of chains B and D complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1fne (more details), 1.9 Å
SCOPe Domain Sequences for d1fned2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fned2 d.19.1.1 (D:4-92) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]} rpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns qpefleqkraevdtvcrhnyeifdnflvp
Timeline for d1fned2: