Lineage for d1fnea1 (1fne A:82-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747463Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2747466Domain d1fnea1: 1fne A:82-182 [59896]
    Other proteins in same PDB: d1fnea2, d1fneb1, d1fneb2, d1fnec2, d1fned1, d1fned2
    complexed with nag

Details for d1fnea1

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (A:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnea1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOPe Domain Coordinates for d1fnea1:

Click to download the PDB-style file with coordinates for d1fnea1.
(The format of our PDB-style files is described here.)

Timeline for d1fnea1: