Lineage for d1fneb1 (1fne B:93-188)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358779Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2358881Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2358884Domain d1fneb1: 1fne B:93-188 [59898]
    Other proteins in same PDB: d1fnea1, d1fnea2, d1fneb2, d1fnec1, d1fnec2, d1fned2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1fneb1

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (B:) protein (MHC class II I-ek, beta chain)

SCOPe Domain Sequences for d1fneb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fneb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOPe Domain Coordinates for d1fneb1:

Click to download the PDB-style file with coordinates for d1fneb1.
(The format of our PDB-style files is described here.)

Timeline for d1fneb1: