Lineage for d2nllb_ (2nll B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Thyroid hormone receptor (TR-beta) DNA-binding domain [57724] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57725] (1 PDB entry) 
Domain d2nllb_: 2nll B: [45115]
Other proteins in same PDB: d2nlla_
Details for d2nllb_
PDB Entry: 2nll (more details), 1.9 Å
PDB Description: retinoid x receptor-thyroid hormone receptor dna-binding domain heterodimer bound to thyroid response element dna
SCOP Domain Sequences for d2nllb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens)}
delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek
SCOP Domain Coordinates for d2nllb_:
Click to download the PDB-style file with coordinates for d2nllb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nllb_:
- d2nllb_ appears in SCOP 1.57
- d2nllb_ appears in the current release, SCOPe 2.08
View in 3D
