Lineage for d2nlla_ (2nll A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41393Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 41421Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 41422Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries)
  8. 41424Domain d2nlla_: 2nll A: [45109]
    Other proteins in same PDB: d2nllb_

Details for d2nlla_

PDB Entry: 2nll (more details), 1.9 Å

PDB Description: retinoid x receptor-thyroid hormone receptor dna-binding domain heterodimer bound to thyroid response element dna
PDB Compounds: (A:)

SCOP Domain Sequences for d2nlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlla_ g.39.1.2 (A:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
clamgm

SCOP Domain Coordinates for d2nlla_:

Click to download the PDB-style file with coordinates for d2nlla_.
(The format of our PDB-style files is described here.)

Timeline for d2nlla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nllb_