PDB entry 2nll

View 2nll on RCSB PDB site
Description:
Deposited on 1996-11-20, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2nlla_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2nllb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nllA (A:)
    caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
    clamgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nllB (B:)
    delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
    crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek