|  | Class g: Small proteins [56992] (54 folds) | 
|  | Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) | 
|  | Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families)  | 
|  | Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins) | 
|  | Protein Transcription factor IIIA, TFIIIA [57693] (1 species) | 
|  | Species Xenopus laevis [TaxId:8355] [57694] (2 PDB entries) | 
|  | Domain d1tf6a1: 1tf6 A:10-40 [45060] | 
PDB Entry: 1tf6 (more details), 3.1 Å
SCOP Domain Sequences for d1tf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf6a1 g.37.1.1 (A:10-40) Transcription factor IIIA, TFIIIA {Xenopus laevis}
ykryicsfadcgaaynknwklqahlckhtge
Timeline for d1tf6a1: