Lineage for d1tf6a1 (1tf6 A:10-40)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90196Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 90197Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 90198Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 90237Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
  7. 90238Species Xenopus laevis [TaxId:8355] [57694] (2 PDB entries)
  8. 90242Domain d1tf6a1: 1tf6 A:10-40 [45060]

Details for d1tf6a1

PDB Entry: 1tf6 (more details), 3.1 Å

PDB Description: co-crystal structure of xenopus tfiiia zinc finger domain bound to the 5s ribosomal rna gene internal control region

SCOP Domain Sequences for d1tf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf6a1 g.37.1.1 (A:10-40) Transcription factor IIIA, TFIIIA {Xenopus laevis}
ykryicsfadcgaaynknwklqahlckhtge

SCOP Domain Coordinates for d1tf6a1:

Click to download the PDB-style file with coordinates for d1tf6a1.
(The format of our PDB-style files is described here.)

Timeline for d1tf6a1: