| Class g: Small proteins [56992] (56 folds) |
| Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins) |
| Protein Transcription factor IIIA, TFIIIA [57693] (1 species) |
| Species Xenopus laevis [TaxId:8355] [57694] (2 PDB entries) |
| Domain d1tf6a1: 1tf6 A:10-40 [45060] |
PDB Entry: 1tf6 (more details), 3.1 Å
SCOP Domain Sequences for d1tf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tf6a1 g.37.1.1 (A:10-40) Transcription factor IIIA, TFIIIA {Xenopus laevis}
ykryicsfadcgaaynknwklqahlckhtge
Timeline for d1tf6a1: