Lineage for d1drs__ (1drs -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40372Family g.7.1.2: Dendroaspin [57351] (1 protein)
  6. 40373Protein Dendroaspin [57352] (1 species)
  7. 40374Species Dendroaspis jamesoni kaimosae [TaxId:8619] [57353] (1 PDB entry)
  8. 40375Domain d1drs__: 1drs - [44457]

Details for d1drs__

PDB Entry: 1drs (more details)

PDB Description: three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin

SCOP Domain Sequences for d1drs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drs__ g.7.1.2 (-) Dendroaspin {Dendroaspis jamesoni kaimosae}
ricynhlgtkppttetcqedscykniwtfdniirrgcgcftprgdmpgpyccesdkcnl

SCOP Domain Coordinates for d1drs__:

Click to download the PDB-style file with coordinates for d1drs__.
(The format of our PDB-style files is described here.)

Timeline for d1drs__: