PDB entry 1drs

View 1drs on RCSB PDB site
Description: three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Deposited on 1994-09-29, released 1994-12-20
The last revision prior to the SCOP 1.55 freeze date was dated 1994-12-20, with a file datestamp of 1995-01-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1drs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1drs_ (-)
    ricynhlgtkppttetcqedscykniwtfdniirrgcgcftprgdmpgpyccesdkcnl