Lineage for d1drsa_ (1drs A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032357Family g.7.1.2: Dendroaspin [57351] (1 protein)
    automatically mapped to Pfam PF00087
  6. 3032358Protein Dendroaspin [57352] (1 species)
    lacks neurotoxicity; acts as the disintegrins: contains RGD-motif
  7. 3032359Species Dendroaspis jamesoni kaimosae [TaxId:8619] [57353] (1 PDB entry)
  8. 3032360Domain d1drsa_: 1drs A: [44457]

Details for d1drsa_

PDB Entry: 1drs (more details)

PDB Description: three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
PDB Compounds: (A:) dendroaspin

SCOPe Domain Sequences for d1drsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1drsa_ g.7.1.2 (A:) Dendroaspin {Dendroaspis jamesoni kaimosae [TaxId: 8619]}
ricynhlgtkppttetcqedscykniwtfdniirrgcgcftprgdmpgpyccesdkcnl

SCOPe Domain Coordinates for d1drsa_:

Click to download the PDB-style file with coordinates for d1drsa_.
(The format of our PDB-style files is described here.)

Timeline for d1drsa_: