PDB entry 1drs

View 1drs on RCSB PDB site
Description: three-dimensional structure of the rgd-containing neurotoxin homologue, dendroaspin
Class: cell adhesion protein
Keywords: cell adhesion protein
Deposited on 1994-09-29, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dendroaspin
  Species: Dendroaspis jamesoni kaimosae [TaxId:8619]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28375 (0-58)
  Domains in SCOPe 2.08: d1drsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1drsA (A:)
  ricynhlgtkppttetcqedscykniwtfdniirrgcgcftprgdmpgpyccesdkcnl