![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Thrombomodulin, different EGF-like domains [57225] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries) |
![]() | Domain d1dx5k1: 1dx5 K:345-387 [44308] Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4 complexed with 0gj, ca, fmt, na, nag |
PDB Entry: 1dx5 (more details), 2.3 Å
SCOPe Domain Sequences for d1dx5k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dx5k1 g.3.11.1 (K:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcq
Timeline for d1dx5k1: