![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries) Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620 |
![]() | Domain d1dx5.4: 1dx5 D:,P: [26158] Other proteins in same PDB: d1dx5i1, d1dx5i2, d1dx5i3, d1dx5j1, d1dx5j2, d1dx5j3, d1dx5k1, d1dx5k2, d1dx5k3, d1dx5l1, d1dx5l2, d1dx5l3 complexed with 0gj, ca, fmt, na, nag |
PDB Entry: 1dx5 (more details), 2.3 Å
SCOPe Domain Sequences for d1dx5.4:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dx5.4 b.47.1.2 (D:,P:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp qellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismlek iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d1dx5.4:
![]() Domains from other chains: (mouse over for more information) d1dx5.1, d1dx5.1, d1dx5.1, d1dx5.1, d1dx5.2, d1dx5.2, d1dx5.2, d1dx5.2, d1dx5.3, d1dx5.3, d1dx5.3, d1dx5.3, d1dx5i1, d1dx5i1, d1dx5i2, d1dx5i2, d1dx5i3, d1dx5i3, d1dx5j1, d1dx5j1, d1dx5j2, d1dx5j2, d1dx5j3, d1dx5j3, d1dx5k1, d1dx5k1, d1dx5k2, d1dx5k2, d1dx5k3, d1dx5k3, d1dx5l1, d1dx5l1, d1dx5l2, d1dx5l2, d1dx5l3, d1dx5l3 |