PDB entry 1dx5

View 1dx5 on RCSB PDB site
Description: crystal structure of the thrombin-thrombomodulin complex
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, egf-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor complex
Deposited on 1999-12-20, released 2000-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dx5.1
  • Chain 'B':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dx5.2
  • Chain 'C':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dx5.3
  • Chain 'D':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dx5.4
  • Chain 'E':
    Compound: thrombin inhibitor glu-gly-arg-0qe
    Database cross-references and differences (RAF-indexed):
    • PDB 1DX5 (0-3)
  • Chain 'F':
    Compound: thrombin inhibitor glu-gly-arg-0qe
    Database cross-references and differences (RAF-indexed):
    • PDB 1DX5 (0-3)
  • Chain 'G':
    Compound: thrombin inhibitor glu-gly-arg-0qe
    Database cross-references and differences (RAF-indexed):
    • PDB 1DX5 (0-3)
  • Chain 'H':
    Compound: thrombin inhibitor glu-gly-arg-0qe
    Database cross-references and differences (RAF-indexed):
    • PDB 1DX5 (0-3)
  • Chain 'I':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204 (0-117)
      • result of deglycosyla (19)
      • engineered (111-112)
    Domains in SCOPe 2.06: d1dx5i1, d1dx5i2, d1dx5i3
  • Chain 'J':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204 (0-117)
      • result of deglycosyla (19)
      • engineered (111-112)
    Domains in SCOPe 2.06: d1dx5j1, d1dx5j2, d1dx5j3
  • Chain 'K':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204 (0-117)
      • result of deglycosyla (19)
      • engineered (111-112)
    Domains in SCOPe 2.06: d1dx5k1, d1dx5k2, d1dx5k3
  • Chain 'L':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204 (0-117)
      • result of deglycosyla (19)
      • engineered (111-112)
    Domains in SCOPe 2.06: d1dx5l1, d1dx5l2, d1dx5l3
  • Chain 'M':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • conflict (45)
    Domains in SCOPe 2.06: d1dx5.1
  • Chain 'N':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • conflict (45)
    Domains in SCOPe 2.06: d1dx5.2
  • Chain 'O':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • conflict (45)
    Domains in SCOPe 2.06: d1dx5.3
  • Chain 'P':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • conflict (45)
    Domains in SCOPe 2.06: d1dx5.4
  • Heterogens: FMT, CA, NA, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5A (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5B (B:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5C (C:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5D (D:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5I (I:)
    vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcqmfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdc
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5J (J:)
    vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcqmfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdc
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5K (K:)
    vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcqmfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5L (L:)
    vepvdpcfranceyqcqpldqtsylcvcaegfapiphephrcqmfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdc
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5M (M:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5N (N:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5O (O:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dx5P (P:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknfiendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge