Lineage for d1apoa_ (1apo A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031371Protein Factor X, N-terminal module [57205] (2 species)
  7. 3031372Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. 3031375Domain d1apoa_: 1apo A: [44240]
    complexed with oh

Details for d1apoa_

PDB Entry: 1apo (more details)

PDB Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding
PDB Compounds: (A:) egf-like module of blood coagulation factor x

SCOPe Domain Sequences for d1apoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apoa_ g.3.11.1 (A:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr

SCOPe Domain Coordinates for d1apoa_:

Click to download the PDB-style file with coordinates for d1apoa_.
(The format of our PDB-style files is described here.)

Timeline for d1apoa_: