SCOPe 2.07: Domain d1apoa_: 1apo A:

Lineage for d1apoa_ (1apo A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor X, N-terminal module [57205] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)

8. Domain d1apoa_: 1apo A: [44240]
   complexed with oh

Details for d1apoa_

PDB Entry: 1apo

PDB Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding

PDB Compounds: (A:) egf-like module of blood coagulation factor x

SCOPe Domain Sequences for d1apoa_:

Sequence; same for both SEQRES and ATOM records:

>d1apoa_ g.3.11.1 (A:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr

Timeline for d1apoa_:

• d1apoa_ first appeared (with stable ids) in SCOP 1.55, called d1apo__
  
• d1apoa_ appears in SCOPe 2.06
  
• d1apoa_ appears in the current release, SCOPe 2.08