PDB entry 1apo

View 1apo on RCSB PDB site
Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding
Class: coagulation factor
Keywords: coagulation factor
Deposited on 1992-04-21, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: egf-like module of blood coagulation factor x
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1apoa_
  • Heterogens: OH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apoA (A:)
    kdgdqceghpclnqghckdgigdytctcaegfegkncefstr