Lineage for d1b9ga_ (1b9g A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39556Protein Insulin-like growth factor [57002] (1 species)
  7. 39557Species Human (Homo sapiens) [TaxId:9606] [57003] (6 PDB entries)
  8. 39558Domain d1b9ga_: 1b9g A: [43991]

Details for d1b9ga_

PDB Entry: 1b9g (more details)

PDB Description: insulin-like-growth-factor-1

SCOP Domain Sequences for d1b9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ga_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens)}
gpetlcgaelvdalqfvcgdrgfyfnkpgivdeccfrscdlrrlemycaplkpaksa

SCOP Domain Coordinates for d1b9ga_:

Click to download the PDB-style file with coordinates for d1b9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1b9ga_: