Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin-like growth factor [57002] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries) Uniprot P05019 49-110 |
Domain d1b9ga_: 1b9g A: [43991] C-region deleted |
PDB Entry: 1b9g (more details)
SCOPe Domain Sequences for d1b9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9ga_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]} gpetlcgaelvdalqfvcgdrgfyfnkpgivdeccfrscdlrrlemycaplkpaksa
Timeline for d1b9ga_: