PDB entry 1b9g

View 1b9g on RCSB PDB site
Description: insulin-like-growth-factor-1
Deposited on 1999-02-11, released 1999-02-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-23, with a file datestamp of 1999-02-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b9ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b9gA (A:)
    gpetlcgaelvdalqfvcgdrgfyfnkpgivdeccfrscdlrrlemycaplkpaksa