SCOP 1.63: Domain d1dxrl_: 1dxr L:

Lineage for d1dxrl_ (1dxr L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)

8. Domain d1dxrl_: 1dxr L: [43431]
   Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrh2, d1dxrm_
   complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrl_

PDB Entry: 1dxr, 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrl_:

Sequence; same for both SEQRES and ATOM records:

>d1dxrl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwfynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d1dxrl_:

• d1dxrl_ first appeared (with stable ids) in SCOP 1.55, called d1dxrl1
  
• d1dxrl_ was called d1dxrl1 in SCOP 1.61
  
• d1dxrl_ appears in SCOP 1.65
  
• d1dxrl_ appears in the current release, SCOPe 2.08