SCOP 1.63: Domain d1dxrc_: 1dxr C:

Lineage for d1dxrc_ (1dxr C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
   consists of four heme-binding repeats

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)

8. Domain d1dxrc_: 1dxr C: [19670]
   Other proteins in same PDB: d1dxrh1, d1dxrh2, d1dxrl_, d1dxrm_
   complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrc_

PDB Entry: 1dxr, 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrc_:

Sequence; same for both SEQRES and ATOM records:

>d1dxrc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d1dxrc_:

• d1dxrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxrc_ appears in SCOP 1.61
  
• d1dxrc_ appears in SCOP 1.65
  
• d1dxrc_ appears in the current release, SCOPe 2.08