SCOP 1.63: Domain d1dxrm_: 1dxr M:

Lineage for d1dxrm_ (1dxr M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (8 PDB entries)

8. Domain d1dxrm_: 1dxr M: [43432]
   Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrh2, d1dxrl_
   complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrm_

PDB Entry: 1dxr, 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrm_:

Sequence; same for both SEQRES and ATOM records:

>d1dxrm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d1dxrm_:

• d1dxrm_ first appeared (with stable ids) in SCOP 1.55, called d1dxrm1
  
• d1dxrm_ was called d1dxrm1 in SCOP 1.61
  
• d1dxrm_ appears in SCOP 1.65
  
• d1dxrm_ appears in the current release, SCOPe 2.08