Lineage for d1dxrl_ (1dxr L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027358Species Rhodopseudomonas viridis [TaxId:1079] [81474] (21 PDB entries)
  8. 3027365Domain d1dxrl_: 1dxr L: [43431]
    Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrh2, d1dxrm_
    complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrl_

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)
PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1dxrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwfynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d1dxrl_:

Click to download the PDB-style file with coordinates for d1dxrl_.
(The format of our PDB-style files is described here.)

Timeline for d1dxrl_: