Lineage for d1fvua_ (1fvu A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37426Protein Snake coagglutinin [56446] (3 species)
  7. 37439Species Snake (Bothrops jararaca), botrocetin [56449] (1 PDB entry)
  8. 37440Domain d1fvua_: 1fvu A: [42345]

Details for d1fvua_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin

SCOP Domain Sequences for d1fvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvua_ d.169.1.1 (A:) Snake coagglutinin {Snake (Bothrops jararaca), botrocetin}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOP Domain Coordinates for d1fvua_:

Click to download the PDB-style file with coordinates for d1fvua_.
(The format of our PDB-style files is described here.)

Timeline for d1fvua_: