PDB entry 1fvu

View 1fvu on RCSB PDB site
Description: crystal structure of botrocetin
Deposited on 2000-09-20, released 2001-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fvua_
  • Chain 'B':
    Domains in SCOP 1.55: d1fvub_
  • Chain 'C':
    Domains in SCOP 1.55: d1fvuc_
  • Chain 'D':
    Domains in SCOP 1.55: d1fvud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvuA (A:)
    dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
    qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
    aqknpfvcksppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fvuB (B:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
    cefqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvuB (B:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
    a
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvuC (C:)
    dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
    qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
    aqknpfvcksppp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fvuD (D:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
    cefqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvuD (D:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyliaeyecvaskptnnkwwiipctrfknfvcefq
    a