Lineage for d1fvuc_ (1fvu C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (5 families) 
Family d.169.1.1: C-type lectin domain [56437] (13 proteins) 
Protein Snake coagglutinin [56446] (3 species) Species Snake (Bothrops jararaca), botrocetin [56449] (1 PDB entry) 
Domain d1fvuc_: 1fvu C: [42347]
Details for d1fvuc_
PDB Entry: 1fvu (more details), 1.8 Å
PDB Description: crystal structure of botrocetin
SCOP Domain Sequences for d1fvuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvuc_ d.169.1.1 (C:) Snake coagglutinin {Snake (Bothrops jararaca), botrocetin}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp
SCOP Domain Coordinates for d1fvuc_:
Click to download the PDB-style file with coordinates for d1fvuc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvuc_:
- d1fvuc_ appears in SCOP 1.57
- d1fvuc_ appears in the current release, SCOPe 2.08
View in 3D
