SCOPe 2.08: Domain d7b57a_: 7b57 A:

Lineage for d7b57a_ (7b57 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein automated matches [190808] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188079] (3 PDB entries)

8. Domain d7b57a_: 7b57 A: [422754]
   Other proteins in same PDB: d7b57b_
   automated match to d1h8ba_
   complexed with adp, mes, mg

Details for d7b57a_

PDB Entry: 7b57, 1.95 Å

PDB Description: crystal structure of camkii-actinin complex bound to adp

PDB Compounds: (A:) alpha-actinin-2

SCOPe Domain Sequences for d7b57a_:

Sequence; same for both SEQRES and ATOM records:

>d7b57a_ a.39.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taeqviasfrilasdkpyilaeelrrelppdqaqycikrmpaysgpgsvpgaldyaafss
aly

Timeline for d7b57a_:

• d7b57a_ is new in SCOPe 2.08-stable