SCOPe 2.08: Domain d7b57b_: 7b57 B:

Lineage for d7b57b_ (7b57 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [194605] (31 PDB entries)

8. Domain d7b57b_: 7b57 B: [422834]
   Other proteins in same PDB: d7b57a_
   automated match to d2bdwa_
   complexed with adp, mes, mg

Details for d7b57b_

PDB Entry: 7b57, 1.95 Å

PDB Description: crystal structure of camkii-actinin complex bound to adp

PDB Compounds: (B:) Calcium/calmodulin-dependent protein kinase type II subunit alpha

SCOPe Domain Sequences for d7b57b_:

Sequence; same for both SEQRES and ATOM records:

>d7b57b_ d.144.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tctrfteeyqlfeelgkgafsvvrrcvkvlagqeyaakiintkklsardhqklerearic
rllkhpnivrlhdsiseeghhylifdlvtggelfedivareyyseadashciqqileavl
hchqmgvvhrdlkpenlllasklkgaavkladfglaievegeqqawfgfagtpgylspev
lrkdpygkpvdlwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpea
kdlinkmltinpskritaaealkhpwishrstvascmhrqetvdclkkfnarrklkgail
aam

Timeline for d7b57b_:

• d7b57b_ is new in SCOPe 2.08-stable