Lineage for d1fo4a6 (1fo4 A:192-414)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36457Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 36458Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 36503Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (2 proteins)
  6. 36513Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 36514Species Cow (Bos taurus) [TaxId:9913] [56192] (2 PDB entries)
  8. 36515Domain d1fo4a6: 1fo4 A:192-414 [41758]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5

Details for d1fo4a6

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus)}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOP Domain Coordinates for d1fo4a6:

Click to download the PDB-style file with coordinates for d1fo4a6.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a6: