Lineage for d1fo4b2 (1fo4 B:3-92)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30566Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (6 proteins)
  6. 30598Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 30599Species Cow (Bos taurus) [TaxId:9913] [54319] (2 PDB entries)
  8. 30601Domain d1fo4b2: 1fo4 B:3-92 [37696]
    Other proteins in same PDB: d1fo4a1, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6

Details for d1fo4b2

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4b2 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus)}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOP Domain Coordinates for d1fo4b2:

Click to download the PDB-style file with coordinates for d1fo4b2.
(The format of our PDB-style files is described here.)

Timeline for d1fo4b2: