Lineage for d1fo4a4 (1fo4 A:415-531)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) 
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) 
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (2 proteins) Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) Species Cow (Bos taurus) [TaxId:9913] [55453] (2 PDB entries) 
Domain d1fo4a4: 1fo4 A:415-531 [40227]
Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6
Details for d1fo4a4
PDB Entry: 1fo4 (more details), 2.1 Å
PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
SCOP Domain Sequences for d1fo4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4a4 d.87.2.1 (A:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus)}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds
SCOP Domain Coordinates for d1fo4a4:
Click to download the PDB-style file with coordinates for d1fo4a4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fo4a4:
- d1fo4a4 appears in SCOP 1.57
- d1fo4a4 appears in the current release, SCOPe 2.08
View in 3D
