Lineage for d1dv1a3 (1dv1 A:115-330)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36099Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 36100Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 36117Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 36118Protein Biotin carboxylase subunit of acetyl-CoA carboxylase [56068] (1 species)
  7. 36119Species Escherichia coli [TaxId:562] [56069] (3 PDB entries)
  8. 36120Domain d1dv1a3: 1dv1 A:115-330 [41486]
    Other proteins in same PDB: d1dv1a1, d1dv1a2, d1dv1b1, d1dv1b2

Details for d1dv1a3

PDB Entry: 1dv1 (more details), 1.9 Å

PDB Description: structure of biotin carboxylase (apo)

SCOP Domain Sequences for d1dv1a3:

Sequence, based on SEQRES records: (download)

>d1dv1a3 d.142.1.2 (A:115-330) Biotin carboxylase subunit of acetyl-CoA carboxylase {Escherichia coli}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d1dv1a3 d.142.1.2 (A:115-330) Biotin carboxylase subunit of acetyl-CoA carboxylase {Escherichia coli}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasmrvvrgdaelaqs
ismtraeandmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapap
gitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgv
dlikeqlriaagqplsikqeevhv

SCOP Domain Coordinates for d1dv1a3:

Click to download the PDB-style file with coordinates for d1dv1a3.
(The format of our PDB-style files is described here.)

Timeline for d1dv1a3: