Lineage for d1dv1a1 (1dv1 A:331-446)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18007Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 18044Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 18045Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 18046Protein Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain [51248] (1 species)
  7. 18047Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)
  8. 18048Domain d1dv1a1: 1dv1 A:331-446 [28234]
    Other proteins in same PDB: d1dv1a2, d1dv1a3, d1dv1b2, d1dv1b3

Details for d1dv1a1

PDB Entry: 1dv1 (more details), 1.9 Å

PDB Description: structure of biotin carboxylase (apo)

SCOP Domain Sequences for d1dv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv1a1 b.84.2.1 (A:331-446) Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOP Domain Coordinates for d1dv1a1:

Click to download the PDB-style file with coordinates for d1dv1a1.
(The format of our PDB-style files is described here.)

Timeline for d1dv1a1: