PDB entry 1dv1

View 1dv1 on RCSB PDB site
Description: structure of biotin carboxylase (apo)
Deposited on 2000-01-19, released 2000-06-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dv1A (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv1A (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasmrvvrgdaelaqsismtra
    eandmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpel
    rryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeq
    lriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiy
    agytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqh
    ggtnihylekklgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dv1B (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv1B (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikmrvvrgdaelaqsismtraym
    ekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrryigerc
    akacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlriaagqp
    lsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppy
    ydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihyl
    ekklglqe