![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
![]() | Protein automated matches [226968] (5 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [255535] (3 PDB entries) |
![]() | Domain d4o1zb1: 4o1z B:32-73 [414066] Other proteins in same PDB: d4o1za2, d4o1zb2 automated match to d2ayla2 complexed with hem, mxm, nag |
PDB Entry: 4o1z (more details), 2.4 Å
SCOPe Domain Sequences for d4o1zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1zb1 g.3.11.0 (B:32-73) automated matches {Sheep (Ovis aries) [TaxId: 9940]} pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d4o1zb1: