SCOPe 2.08: Domain d4o1zb1: 4o1z B:32-73

Lineage for d4o1zb1 (4o1z B:32-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (4 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [255535] (3 PDB entries)

8. Domain d4o1zb1: 4o1z B:32-73 [414066]
   Other proteins in same PDB: d4o1za2, d4o1zb2
   automated match to d2ayla2
   complexed with hem, mxm, nag

Details for d4o1zb1

PDB Entry: 4o1z, 2.4 Å

PDB Description: crystal structure of ovine cyclooxygenase-1 complex with meloxicam

PDB Compounds: (B:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d4o1zb1:

Sequence; same for both SEQRES and ATOM records:

>d4o1zb1 g.3.11.0 (B:32-73) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d4o1zb1:

• d4o1zb1 is new in SCOPe 2.08-stable