Lineage for d4o1za1 (4o1z A:32-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (4 species)
    not a true protein
  7. 3031900Species Sheep (Ovis aries) [TaxId:9940] [255535] (3 PDB entries)
  8. 3031901Domain d4o1za1: 4o1z A:32-73 [414064]
    Other proteins in same PDB: d4o1za2, d4o1zb2
    automated match to d2ayla2
    complexed with hem, mxm, nag

Details for d4o1za1

PDB Entry: 4o1z (more details), 2.4 Å

PDB Description: crystal structure of ovine cyclooxygenase-1 complex with meloxicam
PDB Compounds: (A:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d4o1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1za1 g.3.11.0 (A:32-73) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d4o1za1:

Click to download the PDB-style file with coordinates for d4o1za1.
(The format of our PDB-style files is described here.)

Timeline for d4o1za1:

  • d4o1za1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4o1za2