Lineage for d4o1za2 (4o1z A:74-584)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720385Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins)
  6. 2720489Protein automated matches [254619] (1 species)
    not a true protein
  7. 2720490Species Sheep (Ovis aries) [TaxId:9940] [255536] (3 PDB entries)
  8. 2720491Domain d4o1za2: 4o1z A:74-584 [414065]
    Other proteins in same PDB: d4o1za1, d4o1zb1
    automated match to d1eqha1
    complexed with hem, mxm, nag

Details for d4o1za2

PDB Entry: 4o1z (more details), 2.4 Å

PDB Description: crystal structure of ovine cyclooxygenase-1 complex with meloxicam
PDB Compounds: (A:) Prostaglandin G/H synthase 1

SCOPe Domain Sequences for d4o1za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1za2 a.93.1.2 (A:74-584) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOPe Domain Coordinates for d4o1za2:

Click to download the PDB-style file with coordinates for d4o1za2.
(The format of our PDB-style files is described here.)

Timeline for d4o1za2:

  • d4o1za2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4o1za1