Class a: All alpha proteins [46456] (290 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins) |
Protein automated matches [254619] (1 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [255536] (3 PDB entries) |
Domain d4o1zb2: 4o1z B:74-584 [414067] Other proteins in same PDB: d4o1za1, d4o1zb1 automated match to d1eqha1 complexed with hem, mxm, nag |
PDB Entry: 4o1z (more details), 2.4 Å
SCOPe Domain Sequences for d4o1zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1zb2 a.93.1.2 (B:74-584) automated matches {Sheep (Ovis aries) [TaxId: 9940]} iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge vgfnlvktatlkklvclntktcpyvsfhvpd
Timeline for d4o1zb2: