Lineage for d4cuca4 (4cuc A:758-865)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766528Species Streptococcus pneumoniae [TaxId:170187] [419898] (1 PDB entry)
  8. 2766529Domain d4cuca4: 4cuc A:758-865 [413733]
    Other proteins in same PDB: d4cuca1, d4cuca2, d4cuca3, d4cuca5
    automated match to d4cu6a5
    complexed with mpd, so4

Details for d4cuca4

PDB Entry: 4cuc (more details), 2.2 Å

PDB Description: unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa.
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cuca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuca4 b.1.18.0 (A:758-865) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
kkpmvhllphwnwenkelaskvadsegkipvraysnassvelflngkslglktfnkkqts
dgrtyqegananelylewkvayqpgtleaiardesgkeiardkittag

SCOPe Domain Coordinates for d4cuca4:

Click to download the PDB-style file with coordinates for d4cuca4.
(The format of our PDB-style files is described here.)

Timeline for d4cuca4:

  • d4cuca4 is new in SCOPe 2.08-stable