Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [419898] (1 PDB entry) |
Domain d4cuca4: 4cuc A:758-865 [413733] Other proteins in same PDB: d4cuca1, d4cuca2, d4cuca3, d4cuca5 automated match to d4cu6a5 complexed with mpd, so4 |
PDB Entry: 4cuc (more details), 2.2 Å
SCOPe Domain Sequences for d4cuca4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cuca4 b.1.18.0 (A:758-865) automated matches {Streptococcus pneumoniae [TaxId: 170187]} kkpmvhllphwnwenkelaskvadsegkipvraysnassvelflngkslglktfnkkqts dgrtyqegananelylewkvayqpgtleaiardesgkeiardkittag
Timeline for d4cuca4:
View in 3D Domains from same chain: (mouse over for more information) d4cuca1, d4cuca2, d4cuca3, d4cuca5 |