![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [419896] (1 PDB entry) |
![]() | Domain d4cuca5: 4cuc A:866-983 [413734] Other proteins in same PDB: d4cuca1, d4cuca3, d4cuca4 automated match to d4cu6a3 complexed with mpd, so4 |
PDB Entry: 4cuc (more details), 2.2 Å
SCOPe Domain Sequences for d4cuca5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cuca5 b.1.4.0 (A:866-983) automated matches {Streptococcus pneumoniae [TaxId: 170187]} kpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqgqlvgvdnge qasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqvtvftgkk
Timeline for d4cuca5:
![]() Domains from same chain: (mouse over for more information) d4cuca1, d4cuca2, d4cuca3, d4cuca4 |