Lineage for d4cuca5 (4cuc A:866-983)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763275Species Streptococcus pneumoniae [TaxId:170187] [419896] (1 PDB entry)
  8. 2763277Domain d4cuca5: 4cuc A:866-983 [413734]
    Other proteins in same PDB: d4cuca1, d4cuca3, d4cuca4
    automated match to d4cu6a3
    complexed with mpd, so4

Details for d4cuca5

PDB Entry: 4cuc (more details), 2.2 Å

PDB Description: unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa.
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cuca5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuca5 b.1.4.0 (A:866-983) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
kpaavrlikedhaiaadgkdltyiyyeivdsqgnvvptannlvrfqlhgqgqlvgvdnge
qasrerykaqadgswirkafngkgvaivksteqagkftltahsdllksnqvtvftgkk

SCOPe Domain Coordinates for d4cuca5:

Click to download the PDB-style file with coordinates for d4cuca5.
(The format of our PDB-style files is described here.)

Timeline for d4cuca5:

  • d4cuca5 is new in SCOPe 2.08-stable